PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00102603001
Common NameGSBRNA2T00102603001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 323aa    MW: 35644 Da    PI: 9.8145
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00102603001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.21.2e-32162217258
            CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          ep++VNaKQy++I++RRq+Rakle+++kl +k+rkpylheSRh hAl+RpRgsgGrF
  GSBRNA2T00102603001 162 EPVFVNAKQYHAIMRRRQQRAKLEAQNKL-IKARKPYLHESRHVHALKRPRGSGGRF 217
                          8****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.8E-38159220IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.681160220IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.8E-27162217IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.7E-24163185IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860165185IPR018362CCAAT-binding factor, conserved site
PRINTSPR006165.7E-24194217IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MSKKGSTLPY LNTSISWGGM IPNDPLSLKV VDARTEHLHT TKQISFQDQD SPSTQSTCQS  60
YTEVASSGDD HPSRQISFST KSGPEETQRK VSATHTKSGA MTGFPNMHFA PTQANFSFHY  120
ADPQYGGLLA TPYLPHAPTC NPQMVGMVPG RVALPVEITE AEPVFVNAKQ YHAIMRRRQQ  180
RAKLEAQNKL IKARKPYLHE SRHVHALKRP RGSGGRFLNT KKLLQESEQV AAKEQERDKS  240
VQQANMSRFK AHMLQHNKDR GGSTTSGSDV TCVSDGADIF GHTEFQFSGF PIPTQTNRAM  300
LVHGQSNDMH GGGELHHFSV HI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-20162221362NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.133091e-116seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00102603001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895070.0AC189507.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB088E11, complete sequence.
GenBankAC1896070.0AC189607.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH031P22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013649589.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
SwissprotQ93ZH20.0NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A078E3C30.0A0A078E3C3_BRANA; BnaA07g30460D protein
STRINGBra016031.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33492762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.10.0nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]